PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009779843.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 572aa    MW: 62739.9 Da    PI: 4.9425
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009779843.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4501.6e-1371865631374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAeav++++l+ a al+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+e++P+lkf+h
  XP_009779843.1 186 LVHTLMACAEAVQQENLNVAYALVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDSIESSYTDVLQM--HFYETCPYLKFAH 270
                     689****************************************************........44666654445555544..4************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea+ ++++vH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae++gv+fef+ +++++l+dl+
  XP_009779843.1 271 FTANQAILEAFTNCNKVHVIDFSLKQGMQWPALIQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAETIGVEFEFRGFLTNSLADLD 365
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak........ 274
                      e L++++    E++aVn+v++lhrll++++++e+    vL+ +k+++Pk+v++veqea+hn++ Fl+rf eal+yys++fdsle++        
  XP_009779843.1 366 AEILDLRSsteTEVVAVNSVFELHRLLARPGAVEK----VLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSvstssvst 456
                     ****99988899***********************....*********************************************99988899888 PP

            GRAS 275 ......lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgW 362
                            p  ++++ ++++++lgr+i+nvvaceg +r+erhetl++Wr r+++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW
  XP_009779843.1 457 sstgltQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENDGCLMLGW 551
                     88887766777************************************************************************************ PP

            GRAS 363 kdrpLvsvSaWr 374
                     ++rpL+++SaWr
  XP_009779843.1 552 HTRPLIATSAWR 563
                     ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011296.1E-3332105No hitNo description
PfamPF120419.7E-343298IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.425160542IPR005202Transcription factor GRAS
PfamPF035145.5E-135186563IPR005202Transcription factor GRAS
Gene3DG3DSA:1.20.5.4405.7E-4191214No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MKRDRDREKS QDGSSSSKSK FFEEEQPDAG MDELLAVLGY KVKSSDLAEV AQQLEQLEMA  60
MCTTLGDGIS HLSTDTVHKN PSDLSGWVQS MLSELNNTSI PSNFDMIGSI GEKDLCVSPG  120
GGASSNSITI NEQNRIISDD DLRAIPGGAV FATESNKRQR SCVPLTADAT TRPVVLVDSQ  180
ETGVRLVHTL MACAEAVQQE NLNVAYALVR HIGILAVSQS GAMRKVATYF AEALARRIYK  240
IYPQDSIESS YTDVLQMHFY ETCPYLKFAH FTANQAILEA FTNCNKVHVI DFSLKQGMQW  300
PALIQALALR PGGPPAFRLT GIGPPQPDNT DALQQVGWKL AQLAETIGVE FEFRGFLTNS  360
LADLDAEILD LRSSTETEVV AVNSVFELHR LLARPGAVEK VLNSIKQMNP KIVTIVEQEA  420
NHNASVFLDR FNEALHYYST MFDSLESSVS TSSVSTSSTG LTQPIVNNQD LVMSEVYLGR  480
QICNVVACEG VDRVERHETL SQWRVRMNSA GFDPVHLGSN AFKQASMLLA LFAGGDGYRV  540
EENDGCLMLG WHTRPLIATS AWRLKAAGDT KL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-531865634375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0821480.0KR082148.1 Nicotiana benthamiana GAI1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779843.10.0PREDICTED: DELLA protein GAI-like isoform X4
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLM9N8J90.0M9N8J9_NICAT; ELLA domain GRAS family transcription factor
STRINGPGSC0003DMT4000405890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein